PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.011G109400.1
Common NamePHAVU_011G109400g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 258aa    MW: 29552 Da    PI: 6.2854
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.011G109400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.21.3e-151466148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT.....TTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg.....kgRtlkqcksrwqkyl 48
                        +g WT+eEd +l+ +v+ +G ++W+  ++  g       R++k+c++rw +yl
  Phvul.011G109400.1 14 KGTWTPEEDWKLIAYVTTHGHKNWRQLPKFAGnrsapVSRCGKSCRLRWMNYL 66
                        799************************************************97 PP

2Myb_DNA-binding56.94.7e-1872116147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         rg+ T eE+e++v+++k lG++ W+ Ia++++ gR+++++k++w+ +
  Phvul.011G109400.1  72 RGNYTYEEEERIVKLHKILGNR-WSVIASHLP-GRSDNEIKNHWHAH 116
                         899*******************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.197966IPR017930Myb domain
SuperFamilySSF466891.47E-2911113IPR009057Homeodomain-like
SMARTSM007178.3E-131368IPR001005SANT/Myb domain
PfamPF002495.6E-141466IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-221573IPR009057Homeodomain-like
CDDcd001671.15E-91666No hitNo description
PROSITE profilePS5129423.70867121IPR017930Myb domain
SMARTSM007178.0E-1671119IPR001005SANT/Myb domain
PfamPF002491.5E-1572116IPR001005SANT/Myb domain
CDDcd001678.52E-1174117No hitNo description
Gene3DG3DSA:1.10.10.605.4E-2574120IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MVRTPYCDKS GLKKGTWTPE EDWKLIAYVT THGHKNWRQL PKFAGNRSAP VSRCGKSCRL  60
RWMNYLRPGI KRGNYTYEEE ERIVKLHKIL GNRWSVIASH LPGRSDNEIK NHWHAHLKKR  120
FQHNSETNEE VEASNPKHHS LVESIQEESR EVVASSFQNS SLATSQTPDG DFPSPQLTSL  180
SNVLCMISEP EPEPEPASNW NLATDNFADF MEENTDPISA HSWKELYDIS FISEFLTPFV  240
TEPESVCSVY DVWGLFN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-26121215108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2543170.0AC254317.1 Phaseolus vulgaris cultivar G19833 clone PV_GBb030-N06, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007132609.10.0hypothetical protein PHAVU_011G109400g
SwissprotQ7XBH41e-55MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLV7AIB60.0V7AIB6_PHAVU; Uncharacterized protein
STRINGGLYMA06G45570.21e-115(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35633186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.18e-61myb domain protein 15